PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr3P15400_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 749aa    MW: 83297.7 Da    PI: 6.6638
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr3P15400_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.81.4e-2195150156
                            TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            r+k +++t+eq++e+e+lF+++++p++++r++L+k+lgL+ rqVk+WFqNrR++ k
  GSMUA_Achr3P15400_001  95 RKKYHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLSARQVKFWFQNRRTQIK 150
                            7999************************************************9877 PP

2START207.84.3e-652684875206
                            HHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
                  START   5 eaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                             a++el+k+a+a+ p+Wv+s+    e++n+de++++f+++++     +++ea+r++gvv+ ++++lv+ ++d++ qW+  ++    ka
  GSMUA_Achr3P15400_001 268 VALDELIKMATAQGPLWVRSVetgrEILNYDEYVKEFSPDNSrngclRNIEASRETGVVFFDMTRLVQAFMDVN-QWKDLFPcmisKA 354
                            5789***********************************999********************************.************* PP

                            EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
                  START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                            ++++vi +g      g+lqlm+ae q+l+plvp R+ +fvRy+++l+  +w+i+d+S+d  +++  ++s+++++++pSg++ie+ +ng
  GSMUA_Achr3P15400_001 355 AIVDVIFNGqadskdGTLQLMFAEIQMLTPLVPtREIYFVRYCKKLSPSRWAILDISIDKLEENI-DASLMKCRKRPSGCIIEDQDNG 441
                            ***************************************************************98.9********************* PP

                            EEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                  START 161 hskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                            h+kv+wveh+++++++++ l+rs+v +gla+ga++w+atl+ qce+
  GSMUA_Achr3P15400_001 442 HCKVIWVEHMECQKSVIPTLFRSIVTNGLAFGARHWMATLRLQCER 487
                            ********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-2180146IPR009057Homeodomain-like
SuperFamilySSF466896.27E-2086153IPR009057Homeodomain-like
PROSITE profilePS5007118.3592152IPR001356Homeobox domain
SMARTSM003895.4E-1994156IPR001356Homeobox domain
PfamPF000465.7E-1995150IPR001356Homeobox domain
CDDcd000863.85E-1895150No hitNo description
PROSITE patternPS000270127150IPR017970Homeobox, conserved site
PROSITE profilePS5084838.276255490IPR002913START domain
SuperFamilySSF559616.59E-31257487No hitNo description
CDDcd088756.22E-104259486No hitNo description
SMARTSM002343.8E-61264487IPR002913START domain
PfamPF018522.8E-52267487IPR002913START domain
Gene3DG3DSA:3.30.530.207.1E-5297481IPR023393START-like domain
SuperFamilySSF559614.26E-11530741No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010062Biological Processnegative regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 749 aa     Download sequence    Send to blast
MRKHLSSMNN NNIPPVKDFF ASPALSLSLA GVFRNNAAAA AAEVEEGDEG SGGGGQGEQA  60
GISGENSGAA GRSEEDRESN ESQDDNREVG NKRKRKKYHR HTAEQIREME ALFKESPHPD  120
EKQRQQLSKQ LGLSARQVKF WFQNRRTQIK AVQERHENSL LKSEIEKLQE ENRAMRETIK  180
KACCPNCGIA TLSKDTTMTT EEQQLRIENA RLKAEIEKLR RMQGSIPDGN TSPSSSCSAG  240
ADQNKSSLDC YSGFLGLEKS KILEIVNVAL DELIKMATAQ GPLWVRSVET GREILNYDEY  300
VKEFSPDNSR NGCLRNIEAS RETGVVFFDM TRLVQAFMDV NQWKDLFPCM ISKAAIVDVI  360
FNGQADSKDG TLQLMFAEIQ MLTPLVPTRE IYFVRYCKKL SPSRWAILDI SIDKLEENID  420
ASLMKCRKRP SGCIIEDQDN GHCKVIWVEH MECQKSVIPT LFRSIVTNGL AFGARHWMAT  480
LRLQCERSVF FMATNVPTRD CNGVSTLAGR KSILKLGQRM TSIFCQNIGA SGHRTWTKVS  540
TKSGDEIRFT SRKNMNDPGE PPGLIICAVL STWLPVPTMT LFDFLRDESR RAEWDIMLTP  600
GPTQTTVNLA KGQDRGNSVT MHTTTSSERT NIWVLQDSST NAYESMVVFA PVDIDGMQSV  660
MTGCDSSSLA ILPSGFSILP DGLETRPLVI TSRPEERTME GGSLLTIAFQ ILANSSPMAK  720
LTMESVETVN TLVSCTLQNI KKALGCEDG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19296RKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009392419.10.0PREDICTED: homeobox-leucine zipper protein GLABRA 2-like
SwissprotP466070.0HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLM0SEV60.0M0SEV6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P15400_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein